Isolation and characterization of CRF-related diuretic hormones from the whitelined sphinx moth Hyles lineata
- PMID: 10696588
- DOI: 10.1016/s0965-1748(99)00106-x
Isolation and characterization of CRF-related diuretic hormones from the whitelined sphinx moth Hyles lineata
Abstract
We have isolated and characterized two diuretic hormones (DH), Hylli-DH41 and Hylli-DH30, from extracts of whole heads of the lepidopteran Hyles lineata. We monitored the isolation by measuring the ability of fractions to affect levels of cyclic AMP production by Malpighian tubules of Manduca sexta maintained in vitro. These DH are related to a family of vertebrate neuropeptides which includes sauvagine, corticotropin-releasing factor (CRF), and urotensin I. Both Hylli-DH41 (RMPSLSIDLPMSVLRQKLSLE KERKVQALRAAANRNFLNDI-NH2) and Hylli-DH30 (SFSVNPAVEILQHRYMEKVAQNNRNFLNRV-NH2) show extremely high similarity with two DH from the tobacco hornworm M. sexta. This is not surprising because both H. lineata and M. sexta are sphingid moths. The discovery of these DH provides a third example of two CRF-related DH occurring in one insect species.
Similar articles
-
Isolation and identification of a diuretic hormone from Zootermopsis nevadensis.Peptides. 2001 Feb;22(2):147-52. doi: 10.1016/s0196-9781(00)00371-5. Peptides. 2001. PMID: 11179807
-
Cross reactivity studies of CRF-related peptides on insect Malpighian tubules.Comp Biochem Physiol A Physiol. 1995 Jan;110(1):87-93. doi: 10.1016/0300-9629(94)00132-d. Comp Biochem Physiol A Physiol. 1995. PMID: 7866779
-
Isolation and identification of a new diuretic peptide from the tobacco hornworm, Manduca sexta.Biochem Biophys Res Commun. 1991 Dec 31;181(3):927-32. doi: 10.1016/0006-291x(91)92025-f. Biochem Biophys Res Commun. 1991. PMID: 1764106
-
Phylogeny of the corticotropin-releasing factor family of peptides in the metazoa.Gen Comp Endocrinol. 2006 Mar;146(1):1-8. doi: 10.1016/j.ygcen.2005.11.019. Epub 2006 Feb 10. Gen Comp Endocrinol. 2006. PMID: 16472809 Review.
-
Evolution and physiology of the corticotropin-releasing factor (CRF) family of neuropeptides in vertebrates.Gen Comp Endocrinol. 1999 Jul;115(1):1-22. doi: 10.1006/gcen.1999.7298. Gen Comp Endocrinol. 1999. PMID: 10375459 Review.
Cited by
-
Cockroach diuretic hormones: characterization of a calcitonin-like peptide in insects.Proc Natl Acad Sci U S A. 2000 Jun 6;97(12):6469-74. doi: 10.1073/pnas.97.12.6469. Proc Natl Acad Sci U S A. 2000. PMID: 10841553 Free PMC article.
-
The role of diuretic hormones (DHs) and their receptors in Drosophila.BMB Rep. 2023 Apr;56(4):209-215. doi: 10.5483/BMBRep.2023-0021. BMB Rep. 2023. PMID: 36977606 Free PMC article. Review.
Publication types
MeSH terms
Substances
Associated data
- Actions
- Actions
Grants and funding
LinkOut - more resources
Full Text Sources