Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation
. 2010 Nov 26;285(48):37733-40.
doi: 10.1074/jbc.M110.137612. Epub 2010 Sep 24.

Methylation of the retinoblastoma tumor suppressor by SMYD2

Affiliations

Methylation of the retinoblastoma tumor suppressor by SMYD2

Louis A Saddic et al. J Biol Chem. .

Abstract

The retinoblastoma tumor suppressor (RB) is a central cell cycle regulator and tumor suppressor. RB cellular functions are known to be regulated by a diversity of post-translational modifications such as phosphorylation and acetylation, raising the possibility that RB may also be methylated in cells. Here we demonstrate that RB can be methylated by SMYD2 at lysine 860, a highly conserved and novel site of modification. This methylation event occurs in vitro and in cells, and it is regulated during cell cycle progression, cellular differentiation, and in response to DNA damage. Furthermore, we show that RB monomethylation at lysine 860 provides a direct binding site for the methyl-binding domain of the transcriptional repressor L3MBTL1. These results support the idea that a code of post-translational modifications exists for RB and helps guide its functions in mammalian cells.

PubMed Disclaimer

Figures

FIGURE 1.
FIGURE 1.
Methylation of human RB by SMYD2 at lysine 860 in vitro. A, schematic representation showing RB N-terminal region (N), its pocket (A, I, B), and its C-terminal domain. Known acetylated (Ac) lysines (positions 873 and 874) and the lysine methylated by SMYD2 (position 860) are shown. B, RB is methylated by SMYD2 at lysine 860 in vitro. Autoradiograms (3H) of histone methyltransferase (HMTase) assays with recombinant RB fragments (GST-RB) and SMYD2. Single amino acid substitutions (K-R) are indicated. Coomassie Blue staining shows the amount of RB protein loaded. C, C-term RB methylation is specific to SMYD2. Autoradiogram of an HMTase assay with GST-RB fragments and SET9. D, RB lysine 860 is highly conserved. Conservation of the sequences surrounding RB lysine 860 (in red) in several species.
FIGURE 2.
FIGURE 2.
Mass spectrometry analysis of RB methylation by SMYD2 in vitro. A, RB is monomethylated by SMYD2. Modified peptides identified, charge state, and highest scoring site of modification (degree of methylation) in the RB/SMYD2 mass spectrometry analysis are shown. Lysine 860 is bolded and underlined. B, electron transfer dissociation (ETD) MS/MS spectrum matching charge state 6+ for the peptide ILVSIGESFGTSEKFQKINQMVCNSDRVLK(Me)R and corresponding fragmentation map. Matched c- and z-ions are indicated on the fragmentation map along with their m/z values. Matched c- and z-ions as well as charge-reduced precursors are labeled on the MS/MS spectrum. Lysine monomethylation can be localized to Lys-860 and not Lys-844 or Lys-847 based on site-determining ions.
FIGURE 3.
FIGURE 3.
Methylation of human RB by SMYD2 at lysine 860 in vivo. A, RBK860me1 antibody recognizes monomethyl Lys-860 RB. The specificity of polyclonal antibodies recognizing monomethylated Lys-860 in the RB protein (RBK860me1) was assessed by dot blot analysis with biotinylated peptides. A peptide from histone H4 (amino acids 1–20) serves as a negative control. Streptavidin was used as a positive control and a loading control. B, overexpressed SMYD2 monomethylates overexpressed RB at lysine 860 in 293T cells. Whole cell extracts from 293T cells transfected with the indicated plasmids were immunoprecipitated with HA resin and analyzed by immunoblot with RB, RBK860me1, and E2F antibodies. Controls include lysine to arginine substitutions in RB at Lys-860 and Lys-870, -873, -874 as well as a mutant form of SMYD2 (Y290F) with decreased methyltransferase activity. Inputs for HA-RB and MYC-SMYD2 are shown. C, overexpressed SMYD2 monomethylates endogenous RB at lysine 860. Whole cell extracts of 293T cells were immunoprecipitated with antibodies against RB or control IgG antibodies followed by immunoblot analysis with RB and RBK860me1 antibodies. Inputs for RB and MYC-SMYD2 are shown. D, methylation of endogenous RB at K860 in U2OS cells is decreased upon knockdown of SMYD2. shRNA molecules against SMYD2 (shSMYD2) were stably expressed from a lentiviral vector. Cells infected with an empty lentivirus serve as a control. Whole cell extracts were immunoprecipitated with antibodies against RBK860me1 or control IgG antibodies followed by immunoblot analysis with RB. Inputs for RB and actin are shown. The efficiency of the knockdown was measured by quantitative RT-PCR. One representative quantification of the knockdown is indicated.
FIGURE 4.
FIGURE 4.
Regulation of RB methylation at lysine 860 in vivo. A, methylation of RB accumulates in G0. Quiescent T98G cells were stimulated with 20% serum and RB methylation was measured by immunoprecipitation of whole cell extracts with RBK860me1 antibody and immunoblot analysis with RB antibody. Note that RB becomes hyperphosphorylated as cells re-enter the cell cycle, and that the levels of the RB/E2F target p107 increase as cells progress into S phase. Actin serves as a loading control. Propidium iodide FACS profiles (bottom) show cell cycle re-entry. B, methylated RB accumulates as C2C12 myoblasts differentiate. Whole cell extracts from differentiating C2C12 myoblasts were immunoprecipitated with RBK860me1 antibody followed by immunoblot for RB. Input levels of RB are shown along with actin as a loading control (top). A replicate of this experiment is shown with RB loading equalized from day 0 to day 2 (middle). Photographs at days 0 and 2 show the differentiation into myotubes (bottom). C, RB methylation accumulates with DNA damage. Whole cell extracts from NIH3T3 cells treated with etoposide for the indicated time periods were immunoprecipitated with RBK860me1 followed by immunoblot analysis. Immunoblotting input with the phospho-H2AX epitope (γH2AX) serves as a positive control for the accumulation of DNA damage. Input levels of RB are shown along with actin as a loading control.
FIGURE 5.
FIGURE 5.
RB methylation at Lys-860 increases its interaction with the MBT domains of L3MBTL1 in vitro. A, 3xMBT from L3MBTL1 preferentially binds mono- and dimethyl K860 RB fragments. Pull-down assays of biotinylated RB and H4 peptides containing varying degrees of methylation with GST-tagged 3xMBT from L3MBTL1. B, mutations in key residues of the methyl-binding pocket of 3xMBT L3MBTL1 reduce binding to methylated RB fragments. Pull-down assays of biotinylated RBK860me0 and RBK860me1 peptides with 3xMBT L3MBTL1 mutants. Input levels of the RB fragment are shown to the left of each blot. C and D, calorimetry assays confirm and quantify binding of methylated RB to 3xMBT L3MBTL1. Isothermal titration calorimetry assays were performed to measure the affinity of the interaction between RB and the 3xMBT domain of L3MBTL1. Only the interaction with the monomethylated RB peptide is shown in C. All the data are quantified in D; no Kd could be determined for K860me0 and K860me3 because of the low affinity of the interaction.
FIGURE 6.
FIGURE 6.
RB methylation at Lys-860 increases its interaction with the MBT domains of L3MBTL1 in vivo. A, monomethyl Lys-860 RB can be localized to chromatin. 293T cells were fractionated by detergent lysis to generate a cytoplasmic S2 fraction, a nuclear S3 fraction, and a chromatin (Chr) fraction. Fractions were then analyzed by immunoblot with antibodies against RB and RBK860me1. Tubulin and H3K4tri-me were used to assess the purity of the fractionation. B, overexpression of SMYD2 increases binding of RB to L3MBTL1. 293T cells were transfected with the indicated expression plasmids. Whole cell extracts were immunoprecipitated with FLAG resin and analyzed by immunoblot with antibodies against RB, RBK860me1, and L3MBTL1. Inputs for FLAG-L3MBTL1, MYC-SMYD2, and RB are shown. C, D355N mutation in the methyl-binding pocket of L3MBTL1 reduces the affinity of L3MBTL1 for RB. 293T cells were transfected with the indicated expression plasmids. IP was performed as in B and analyzed by immunoblot with antibodies against RB, RBK860me1, and L3MBTL1. Inputs for FLAG-L3MBTL1, FLAG-L3MBTL1(D355N), RB, and MYC-SMYD2 are shown. D, RB(K860R) mutation reduces the affinity of RB for L3MBTL1. 293T cells were transfected with the indicated expression plasmids. Immunoprecipitation was performed as in B and C and analyzed by immunoblot with antibodies against HA, RBK860me1, and L3MBTL1. Inputs for FLAG-L3MBTL1, HA-RB, HA-860, and MYC-SMYD2 are shown. Tubulin serves as a loading control.

Similar articles

Cited by

References

    1. Knudsen E. S., Knudsen K. E. (2008) Nat. Rev. Cancer 8, 714–724 - PMC - PubMed
    1. Burkhart D. L., Sage J. (2008) Nat. Rev. Cancer 8, 671–682 - PMC - PubMed
    1. Sherr C. J., McCormick F. (2002) Cancer Cell 2, 103–112 - PubMed
    1. Weinberg R. A. (1995) Cell 81, 323–330 - PubMed
    1. Inoue Y., Kitagawa M., Taya Y. (2007) EMBO J. 26, 2083–2093 - PMC - PubMed

Publication types

MeSH terms